- Species:Human
- Host Species:E. coli
- MW:15 kDa
|
- Genbank #:NM_033445
- Tag(s):N-terminal His-tag, Biotin
- a.a:2–130(end)
|
| Description: |
Biotinylated Human Histone 2A, GenBank Accession No. NM_033445, a.a. 2-130(end) with N-terminal His-tag and C-terminal Cys. MW = 15 kDa, expressed in an <i>E. coli</i> expression system. |
| UniProt |
Q7L7L0 |
| Synonym(s): |
HIST1H2AI, H2A.1, histone H2A |
| Formulation: |
8 mM PBS pH 7.4, 110 mM NaCl, 2.2 mM KCl, 20% glycerol and 3 mM DTT. |
| Format: |
Aqueous buffer solution |
| Storage / Stability: |
>6 months at |
| Application(s): |
Useful as a substrate for histone methyltransferase and acetyltransferase assays. Ideal for screening small molecular inhibitors of histone modifying enzymes for drug discovery and HTS applications. |
| Reference(s): |
1. Osley, M.A. Brief Funct. Genomic
Proteomic 5(3):179-89 (2006).
2. Wyrick, J.J. and Parra, M.A.. Biochim
Biophys Acta. 1789(1):37-44 (2009).
3. Zhou, W., et al. Int J Biochem Cell Biol.
41(1):12-5 (2009). |
| Warning(s): |
Avoid freeze/thaw cycles |
| Amino Acid Sequence: |
MHHHHHHSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGKC |
| Scientific Category: |
Methyltransferase(s) |
| Product Type: |
Substrates |
