- Species:Human
- Host Species:E. coli
- MW:22 kDa
|
- Genbank #:NM_005318
- Tag(s):N-terminal His-tag
- a.a:2–194(end)
|
| Description: |
Human Histone H1, also known as H1F0, (GenBank Accession No. NM_005318), a.a. 2-194(end) with N-terminal His-tag, MW = 21.7 kDa, expressed in an <i>E. coli</i> expression system. |
| UniProt |
P07305 |
| Synonym(s): |
Histone H1, H1F0 |
| Formulation: |
8 mM PBS pH 7.4, 110 mM NaCl, 2.2 mM KCl, 3 mM DTT, and 20% glycerol. |
| Format: |
Aqueous buffer solution |
| Storage / Stability: |
≥ 6 months at -80°C |
| Application(s): |
Useful as a substrate for histone methyltransferase and acetyltransferase assays. Ideal for screening small molecular inhibitors of histone modifying enzymes for drug discovery and HTS applications. |
| Reference(s): |
1. Doenecke, D., et al., J. Mol.Biol. 1986
Feb 5; 187(3):461-4.
2. Vyas, P., et al., J. Biol. Chem. 2012 Apr
6; 287(15):11778-87. |
| Warning(s): |
Avoid freeze/thaw cycles |
| Amino Acid Sequence: |
MHHHHHHTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKKSVAFKKTKKEIKKVATPKKASKPKKAASKAPTKKPKATPVKKAKKKLAATPKKAKKPKTVKAKPVKASKPKKAKPVKPKAKSSAKRAGKKK |
| Scientific Category: |
Inhibitors / Activators |
| Product Type: |
Methyltransferase |
